Product Overview
Description
CLPP-00151350 is recombinant Rhesus monkey GHR protein, His tag
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY
Sequence Similarities
Belongs to the type I cytokine receptor family. Type 1 subfamily. Contains 1 fibronectin type-III domain.
Predicted Molecular Weight
30 kDa including tags
Target Information
Alternative Names
GH receptor; GH-binding protein; GHBP; GHBP, included; GHR; GHR_HUMAN; Growth hormone binding protein; Growth hormone receptor; Growth hormone receptor precursor; Growth hormone-binding protein; Growth hormone-binding protein, included; Increased responsiveness to growth hormone, included; Serum binding protein; Serum-binding protein; Somatotropin receptor
Protein Function
Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway (By similarity); The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.; Isoform 2 up-regulates the production of GHBP and acts as a negative inhibitor of GH signaling.
Tissue Specificity
Expressed in various tissues with high expression in liver and skeletal muscle. Isoform 4 is predominantly expressed in kidney, bladder, adrenal gland and brain stem. Isoform 1 expression in placenta is predominant in chorion and decidua. Isoform 4 is highly expressed in placental villi. Isoform 2 is expressed in lung, stomach and muscle. Low levels in liver.
Involvement in Disease
Defects in GHR are a cause of Laron syndrome (LARS). A severe form of growth hormone insensitivity characterized by growth impairment, short stature, dysfunctional growth hormone receptor, and failure to generate insulin-like growth factor I in response to growth hormone.Defects in GHR may be a cause of idiopathic short stature autosomal (ISSA). Short stature is defined by a subnormal rate of growth.
Shipping & Handling
Constituents
Tris buffer, 50% Glycerol (glycerin, glycerine).
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.