Product Overview
Description
Recombinant rat EGF protein
Applications
Functional Studies, HPLC, Mass Spectrometry, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Endotoxin Level
< 0.005 Eu/µg
Sequence
NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
Sequence Similarities
Contains 9 EGF-like domains. Contains 9 LDL-receptor class B repeats.
Target Information
Alternative Names
Beta urogastrone; beta-urogastrone; EGF; EGF_HUMAN; Epidermal growth factor; HOMG4; OTTHUMP00000219721; OTTHUMP00000219722; Pro epidermal growth factor; URG; Urogastrone
Protein Function
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro.
Tissue Specificity
Expressed in kidney, salivary gland, cerebrum and prostate.
Involvement in Disease
Hypomagnesemia 4.
Shipping & Handling
Constituents
0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose.
Shipping
Shipped at Room Temperature.
Storage
Store at room temperature.
