Product Overview
Description
CLPP-00151326 is recombinant mouse ROMO1 protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM
MQSGGTFGTFMAIGMGIRC
Sequence Similarities
Belongs to the MGR2 family.
Predicted Molecular Weight
11 kDa including tags
Target Information
Alternative Names
bA353C18.2; C20orf52; Mitochondrial targeting GXXXG protein; MTGMP; Protein MGR2 homolog; Reactive oxygen species modulator 1; ROMO1; ROMO1_HUMAN; ROS modulator 1
Protein Function
Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation.; Has antibacterial activity against a variety of bacteria including S.aureus, P.aeruginosa and M.tuberculosis. Acts by inducing bacterial membrane breakage.
Tissue Specificity
Up-regulated in a number of cancer cell lines when compared to a normal lung fibroblast cell line.
Shipping & Handling
Constituents
0.05% 2-Octadecoxyethanol, 6% Trehalose, 0.79% Sodium chloride, 0.14% Dibasic monohydrogen sodium phosphate, 0.024% Monobasic dihydrogen potassium phosphate, 0.02% Potassium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
