Product Overview
Description
CLPP-00151325 is recombinant mouse PEBP1 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAADISQWAGPLCLQEVDEPPQHALRVDYAGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRYVWLVYEQEQPLSCDEPILSNKSGDNRGKFKVETFRKKYNLGAPVAGTCYQAEWDDYVPKLYEQLSGK
Sequence Similarities
Belongs to the phosphatidylethanolamine-binding protein family.
Predicted Molecular Weight
23 kDa including tags
Target Information
Alternative Names
Epididymis luminal protein 210; Epididymis secretory protein Li 34; Epididymis secretory protein Li 96; HCNP; HCNPpp; HEL 210; HEL S 34; HEL S 96; Hippocampal cholinergic neurostimulating peptide; Neuropolypeptide h3; PBP; PEBP; PEBP 1; PEBP-1; Pebp1; PEBP1_HUMAN; Phosphatidylethanolamine binding protein; Phosphatidylethanolamine binding protein 1; Prostatic binding protein; Prostatic-binding protein; R kip; Raf kinase inhibitor protein; Raf kinase inhibitory protein; RKIP
Protein Function
Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase (By similarity). Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation; HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor (By similarity).
Shipping & Handling
Constituents
10% Glycerol (glycerin, glycerine), 90% PBS.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
