Product Overview
Description
CLPP-00151313 is recombinant mouse IL17RB protein, Fc Chimera His Tag
Protein Length
Protein fragment
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
ADPREPTIQCGSETGPSPEWMVQHTLTPGDLRDLQVELVKTSVAAEEFSILMNISWILRADASIRLLKATKICVSGKNNMNSYSCVRCNYTEAFQSQTRPSGGKWTFSYVGFPVELSTLYLISAHNIPNANMNEDSPSLSVNFTSPGCLNHVMKYKKQCTEAGSLWDPDITACKKNEKMVEVNFTTNPLGNRYTILIQRDTTLGFSRVLENKLMRTSVAIPVTEESEGAVVQLTPYLHTCGNDCIRREGTVVLCSETSAPIPPDDNRRMLGGVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Sequence Similarities
Contains 1 SEFIR domain.
Predicted Molecular Weight
57 kDa including tags
Target Information
Alternative Names
CRL 4; CRL4; Cytokine receptor CRL4; Cytokine receptor-like 4; EVI 27; EVI27; I17RB_HUMAN; IL 17 receptor B; IL 17 receptor homolog 1; IL 17B receptor; IL 17RB; IL 17Rh1; IL-17 receptor B; IL-17 receptor homolog 1; IL-17B receptor; IL-17RB; IL-17Rh1; IL17B Receptor; IL17BR; IL17RB; IL17Rh1; Interleukin 17 receptor B; Interleukin 17 receptor homolog; Interleukin 17 receptor homolog 1; Interleukin 17B receptor; Interleukin-17 receptor B; Interleukin-17B receptor; MGC5245
Protein Function
Receptor for the pro-inflammatory cytokines IL17B and IL17E. May play a role in controlling the growth and/or differentiation of hematopoietic cells.
Tissue Specificity
Expressed in several endocrine tissues, mostly in fetal and adult liver, kidney, pancreas, testis, colon, brain and small intestine; not detected in peripheral blood leukocytes, lymphoid organs, and most cell lines.
Shipping & Handling
Constituents
10% Glycerol (glycerin, glycerine), PBS.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.