Product Overview
Description
CLPP-00151307 is recombinant mouse GDF10 protein, Fc Chimera
Protein Length
Full length protein
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIVPGIPEPCCVPDKMNSLGVLFLDENRNAVLKVYPNMSVETCACR
Sequence Similarities
Belongs to the TGF-beta family.
Predicted Molecular Weight
41 kDa including tags
Target Information
Alternative Names
BIP; BMP 3b; BMP-3b; BMP3B; BMP3B_HUMAN; Bone inducing protein; Bone morphogenetic protein 3b; Bone morphogenetic protein 3b [Precursor]; Bone-inducing protein; GDF 10; GDF-10; Gdf10; growth differentiation factor 10; Growth/differentiation factor 10
Protein Function
Growth factor involved in osteogenesis and adipogenesis. Plays an inhibitory role in the process of osteoblast differentiation via SMAD2/3 pathway. Plays an inhibitory role in the process of adipogenesis.
Tissue Specificity
Expressed in femur, brain, lung, skeletal muscle, pancreas and testis.
Shipping & Handling
Shipping
Shipped at Room Temperature.
Storage
Store at -20 °C or -80 °C.
