Product Overview
Description
CLPP-00151291 is recombinant mouse CXCL1 protein
Applications
Functional Studies, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Sequence Similarities
Belongs to the intercrine alpha (chemokine CxC) family.
Predicted Molecular Weight
11 kDa
Target Information
Alternative Names
C-X-C motif chemokine 1; chemokine (C-X-C motif) ligand 1; Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha); CINC-1; CXCL1; Cytokine-induced neutrophil chemoattractant 1; Fibroblast secretory protein; Fsp; Gro; Gro 1; Gro A; GRO protein, alpha; GRO-alpha(1-73); GRO-alpha(6-73); Gro1; Gro1 oncogene; GRO1 oncogene (melanoma growth stimulating activity, alpha); GRO1 oncogene (melanoma growth-stimulating activity); GROa; GROA_HUMAN; Growth-regulated alpha protein; KC; KC chemokine, mouse, homolog of; Melanoma growth stimulatory activity; melanoma growth stimulatory activity alpha; Melanoma growth stimulatory activity, alpha; MGSA; MGSA alpha; MGSA-a; N51; NAP-3; NAP3; Neutrophil-activating protein 3; Platelet-derived growth factor-inducible protein KC; Scyb 1; Scyb1; Secretory protein N51; Small inducible cytokine subfamily B, member 1
Protein Function
Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
