Product Overview
Description
CLPP-00151258 is recombinant human UBE2V1 protein, BSA and azide free
Applications
HPLC, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSNLEHHHHHH
Sequence Similarities
Belongs to the ubiquitin-conjugating enzyme family.
Predicted Molecular Weight
18 kDa including tags
Target Information
Alternative Names
CIR1; CROC-1; CROC1; CROC1A; TRAF6-regulated IKK activator 1 beta Uev1A; UB2V1_HUMAN; UBE2V; UBE2V 1; UBE2V1; Ubiquitin conjugating enzyme E2 variant 1; Ubiquitin-conjugating enzyme E2 variant 1; UEV-1; UEV1
Protein Function
Has no ubiquitin ligase activity on its own. The UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6 and TRAF2. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UBE2N, catalyzes the viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIGI to activate the downstream signaling pathway that leads to interferon beta production. UBE2V1-UBE2N together with TRAF3IP2 E3 ubiquitin ligase mediate 'Lys-63'-linked polyubiquitination of TRAF6, a component of IL17A-mediated signaling pathway.
Tissue Specificity
Highly expressed in thyroid, pancreas, spinal cord, lymph node, trachea, adrenal gland, bone marrow and pancreas. Detected at low levels in heart, breast, placenta, brain, liver, kidney, stomach and lung.
Shipping & Handling
Constituents
1.19% HEPES, 0.58% Sodium chloride. Supplied as a 0.2 µM filtered solution.
Shipping
Shipped on Dry Ice.
Storage
Store at -20 °C or -80 °C.
