Product Overview
Description
CLPP-00151242 is recombinant human TSPAN1 protein, Fc Chimera
Protein Length
Protein fragment
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
YTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTN
Predicted Molecular Weight
38 kDa including tags
Target Information
Alternative Names
Tetraspanin TM4 C; Tetraspanin TM4C; NET 1; NET1; Tetraspan 1; Tetraspan NET 1; Tetraspan NET1; Tetraspanin 1; TM4C; TM4SF; TSPAN 1; Tspan1
Protein Function
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
Shipping & Handling
Shipping
Shipped at Room Temperature.
Storage
Store at -20 °C or -80 °C.