Product Overview
Description
CLPP-00151238 is recombinant human DCT protein
Applications
ELISA, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
CTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITT
Sequence Similarities
Belongs to the tyrosinase family.
Target Information
Alternative Names
L dopachrome tautomerase; DCT; Dopachrome delta isomerase; Dopachrome tautomerase; Dopachrome tautomerase dopachrome delta isomerase, tyrosine related protein 2; DT; EC 5.3.3.12; L dopachrome Delta isomerase; L-dopachrome Delta-isomerase; L-dopachrome tautomerase; TRP 2; TRP-2; TRP2; Tyrosinase related protein 2; Tyrosinase-related protein 2; TYRP2; TYRP2_HUMAN
Protein Function
Plays a role in melanin biosynthesis. Catalyzes the conversion of L-dopachrome into 5,6-dihydroxyindole-2-carboxylic acid (DHICA).
Involvement in Disease
Albinism, oculocutaneous, 8 (OCA8): A form of oculocutaneous albinism, a disorder of pigmentation characterized by reduced biosynthesis of melanin in the skin, hair and eyes. OCA8 is an autosomal recessive form characterized by mild hair and skin hypopigmentation, associated with ocular features including nystagmus, reduced visual acuity, iris transillumination, and hypopigmentation of the retina. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.