Product Overview
Description
CLPP-00151226 is recombinant human SERTAD2 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSMLGKGGKRKFDEHEDGLEGKIVSPCDGPSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASPSSHPCDLGSTTPLEACLTPASLLEDDDDTFCTSQAMQPTAPTKLSPPALLPEKDSFSSALDEIEELCPTSTSTEAATAATDSVKGTSSEAGTQKLDGPQESRADDSKLMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSADDLLKTLAPYSSQPVTPSQPFKMDLTELDHIMEVLVGS
Predicted Molecular Weight
36 kDa including tags
Target Information
Alternative Names
KIAA0127; MGC126688; MGC126690; Sei 2; Sei-2; Sei2; SERTA domain containing 2; SERTA domain-containing protein 2; SERTAD2; SRTD2_HUMAN; Transcriptional regulator interacting with the PHD bromodomain 2; Transcriptional regulator interacting with the PHD-bromodomain 2; Transcriptional regulator interacting with the PHS-bromodomain 2; TRIP Br2; TRIP-Br2
Protein Function
Acts at E2F-responsive promoters as coregulator to integrate signals provided by PHD- and/or bromodomain-containing transcription factors. May act as coactivator as well as corepressor of E2F1-TFDP1 and E2F4-TFDP1 complexes on E2F consensus binding sites, which would activate or inhibit E2F-target genes expression. Modulates fat storage by down-regulating the expression of key genes involved in adipocyte lipolysis, thermogenesis and oxidative metabolism.
Shipping & Handling
Constituents
0.32% Tris HCl, 0.88% Sodium chloride, 10% Glycerol (glycerin, glycerine), 0.02% DTT.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
