Product Overview
Description
CLPP-00151218 is recombinant human TPPP protein
Applications
ELISA, Mass Spectrometry, SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MKHHHHHHASMADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
Sequence Similarities
Belongs to the TPPP family.
Predicted Molecular Weight
25 kDa including tags
Target Information
Alternative Names
25 kDa brain specific protein; 25 kDa brain-specific protein; Brain specific protein p25 alpha; Glycogen synthase kinase 3 (GSK3) inhibitor p24; OTTHUMP00000161630; p24; p25; p25-alpha; p25alpha; TPPP; TPPP/p25; TPPP_HUMAN; TPPP1; Tubulin polymerization promoting protein; Tubulin polymerization-promoting protein
Protein Function
May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.
Tissue Specificity
Widely expressed.
Shipping & Handling
Constituents
99% Phosphate Buffer, 0.43% Sodium chloride.
Shipping
Shipped at 4 °C.