Product Overview
Description
CLPP-00151217 is recombinant human TPM4 protein, His tag
Protein Length
Full length protein
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
AGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
Sequence Similarities
Belongs to the tropomyosin family.
Predicted Molecular Weight
31 kDa including tags
Target Information
Alternative Names
Epididymis secretory protein Li 108; HEL-S-108; TM30p1; TMP 4; TPM4; TPM4_HUMAN; Tropomyosin 4; Tropomyosin alpha 4 chain; Tropomyosin alpha-4 chain; Tropomyosin-4; wu:fb06e07; zgc:103436; zgc:63909
Protein Function
Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments. Binds calcium.
Tissue Specificity
Detected in cardiac tissue and platelets, the form found in cardiac tissue is a higher molecular weight than the form found in platelets. Expressed at higher levels in the platelets of hypertensive patients with cardiac hypertrophy than in the platelets of hypertensive patients without cardiac hypertrophy (at protein level).
Shipping & Handling
Shipping
Shipped at Room Temperature.
Storage
Store at -20 °C or -80 °C.
