Product Overview
Description
CLPP-00151211 is recombinant human TNNC1 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Sequence Similarities
Belongs to the troponin C family. Contains 4 EF-hand domains.
Predicted Molecular Weight
21 kDa including tags
Target Information
Alternative Names
Cardiac troponin C; CMD1Z; CMH13; slow skeletal and cardiac muscles; Slow twitch skeletal/cardiac muscle troponin C; TN-C; TNC; TNNC; Tnnc1; TNNC1 troponin C type 1 (slow); TNNC1_HUMAN; Troponin C; troponin C type 1 (slow); Troponin C, slow skeletal and cardiac muscles; Troponin C1, slow
Protein Function
Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.
Involvement in Disease
Defects in TNNC1 are the cause of cardiomyopathy dilated type 1Z (CMD1Z). Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.Defects in TNNC1 are the cause of cardiomyopathy familial hypertrophic type 13 (CMH13). A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
Shipping & Handling
Constituents
0.02% DTT, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
