Product Overview
Description
CLPP-00151205 is recombinant human TMSB4X protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Sequence Similarities
Belongs to the thymosin beta family.
Predicted Molecular Weight
31 kDa including tags
Target Information
Alternative Names
Fx; Hematopoietic system regulatory peptide; Prothymosin beta 4; PTMB 4; PTMB4; Seraspenide; T beta 4; T beta-4; TB4X; THYB 4; Thyb4; Thymosin beta 4; Thymosin beta 4 X chromosome; Thymosin beta 4 X linked; TMSB 4; TMSB4; Tmsb4x; TYB4_HUMAN
Protein Function
Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.Seraspenide inhibits the entry of hematopoeitic pluripotent stem cells into the S-phase.
Tissue Specificity
Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
