Product Overview
Description
CLPP-00151202 is recombinant human THPO protein, Active
Applications
Functional Studies, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Sequence Similarities
Belongs to the EPO/TPO family.
Target Information
Alternative Names
C mpl ligand; C-mpl ligand; Megakaryocyte colony stimulating factor; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; Megakaryocyte stimulating factor; MGC163194; MGDF; MKCSF; ML; MPL ligand; MPLLG; Myeloproliferative leukemia virus oncogene ligand; Prepro thrombopoietin; THCYT1; THPO; Thrombopoietin; Thrombopoietin nirs variant 1; TPO; TPO_HUMAN
Protein Function
Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
Involvement in Disease
Defects in THPO are a cause of essential thrombocythemia (ET). ET is inherited as an autosomal dominant trait which is characterized by elevated platelet levels due to sustained proliferation of megakaryocytes, and frequently lead to thrombotic and haemorrhagic complications.
Shipping & Handling
Shipping
Shipped at 4 °C.
