Recombinant Human Tau Protein

Cat. No.: CLPP-00151177

Product Size: 100 µg Custom size

Product Overview

Description
CLPP-00151177 is recombinant human MAPT protein, Active
Purity
> 95%
Applications
Functional Studies, SDS-PAGE
Protein Length
Protein fragment
Animal Free
No
Nature
Recombinant Protein
Species
Human
Form
Liquid
Sequence
SRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVLGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Sequence Similarities
Contains 4 Tau/MAP repeats.
Predicted Molecular Weight
15 kDa

Target Information

Protein Name
MAPT
UniProt No.
Alternative Names
AI413597; AW045860; DDPAC; FLJ31424; FTDP 17; G protein beta1/gamma2 subunit interacting factor 1; MAPT; MAPTL; MGC134287; MGC138549; MGC156663; Microtubule associated protein tau; Microtubule associated protein tau isoform 4; Microtubule-associated protein tau; MSTD; Mtapt; MTBT1; MTBT2; Neurofibrillary tangle protein; Paired helical filament tau; Paired helical filament-tau; PHF tau; PHF-tau; PPND; PPP1R103; Protein phosphatase 1, regulatory subunit 103; pTau; RNPTAU; TAU; TAU_HUMAN; Tauopathy and respiratory failure; Tauopathy and respiratory failure, included
Protein Function
Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.
Tissue Specificity
Expressed in neurons. Isoform PNS-tau is expressed in the peripheral nervous system while the others are expressed in the central nervous system.
Involvement in Disease
In Alzheimer disease, the neuronal cytoskeleton in the brain is progressively disrupted and replaced by tangles of paired helical filaments (PHF) and straight filaments, mainly composed of hyperphosphorylated forms of TAU (PHF-TAU or AD P-TAU).Defects in MAPT are a cause of frontotemporal dementia (FTD), corticobasal degeneration (CBD), progressive supranuclear palsy type 1 (PSNP1).

Shipping & Handling

pH
pH: 7.4
Constituents
0.24% HEPES, 0.58% Sodium chloride.
Shipping
Shipped on Dry Ice.
Storage
Store at -80 °C.

For Research Use Only. Not For Clinical Use.

Online Inquiry