Product Overview
Description
CLPP-00151146 is recombinant human MAPT protein, biotinylated
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
QTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIE
Sequence Similarities
Contains 4 Tau/MAP repeats.
Target Information
Alternative Names
AI413597; AW045860; DDPAC; FLJ31424; FTDP 17; G protein beta1/gamma2 subunit interacting factor 1; MAPT; MAPTL; MGC134287; MGC138549; MGC156663; Microtubule associated protein tau; Microtubule associated protein tau isoform 4; Microtubule-associated protein tau; MSTD; Mtapt; MTBT1; MTBT2; Neurofibrillary tangle protein; Paired helical filament tau; Paired helical filament-tau; PHF tau; PHF-tau; PPND; PPP1R103; Protein phosphatase 1, regulatory subunit 103; pTau; RNPTAU; TAU; TAU_HUMAN; Tauopathy and respiratory failure; Tauopathy and respiratory failure, included
Protein Function
Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.
Tissue Specificity
Expressed in neurons. Isoform PNS-tau is expressed in the peripheral nervous system while the others are expressed in the central nervous system.
Involvement in Disease
In Alzheimer disease, the neuronal cytoskeleton in the brain is progressively disrupted and replaced by tangles of paired helical filaments (PHF) and straight filaments, mainly composed of hyperphosphorylated forms of TAU (PHF-TAU or AD P-TAU).Defects in MAPT are a cause of frontotemporal dementia (FTD), corticobasal degeneration (CBD), progressive supranuclear palsy type 1 (PSNP1).
Shipping & Handling
Constituents
0.87% Sodium chloride, 0.71% Dibasic monohydrogen sodium phosphate.
Shipping
Shipped on Dry Ice.