Product Overview
Description
CLPP-00150548 is recombinant human SYNM protein
Applications
ELISA, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
VSNVEAIRSRTQEAGALGVSDRGSWRDADSRNDQAVGVSFKASAGEGDQAHREQGKEQAMFDKKVQLQRMVDQRSVISDEKKVALLYLDNEEEENDGHWF
Sequence Similarities
Belongs to the intermediate filament family.
Target Information
Alternative Names
Desmuslin; DMN; KIAA0353; SYN; SYNEM_HUMAN; Synemin; Synemin alpha; Synemin beta; Synemin, intermediate filament protein; SYNM
Protein Function
Type-VI intermediate filament (IF) which plays an important cytoskeletal role within the muscle cell cytoskeleton. It forms heteropolymeric IFs with desmin and/or vimentin, and via its interaction with cytoskeletal proteins alpha-dystrobrevin, dystrophin, talin-1, utrophin and vinculin, is able to link these heteropolymeric IFs to adherens-type junctions, such as to the costameres, neuromuscular junctions, and myotendinous junctions within striated muscle cells.
Tissue Specificity
Isoform 2 is strongly detected in adult heart, fetal skeletal muscles and fetal heart. Isoform 1 is weakly detected in fetal heart and also in fetal skeletal muscle. Isoform 1 and isoform 2 are detected in adult bladder (at protein level). The mRNA is predominantly expressed in heart and muscle with some expression in brain which may be due to tissue-specific isoforms.
Shipping & Handling
Shipping
Shipped on dry ice.
Constituents
0.31% Glutathione, 0.79% Tris HCl.
