Product Overview
Description
CLPP-00151016 is recombinant human SFTPB protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Predicted Molecular Weight
69 kDa including tags
Sequence Similarities
Contains 1 saposin A-type domain. Contains 3 saposin B-type domains.
Target Information
Alternative Names
18 kDa pulmonary-surfactant protein; 6 kDa protein; PSP B; PSPB; PSPB_HUMAN; Pulmonary surfactant apoprotein PSP-B; Pulmonary surfactant-associated protein B; Pulmonary surfactant-associated protein, 18-KD; Pulmonary surfactant-associated proteolipid SPL(Phe); SFTB3; SFTP3; SFTPB; SMDP1; SP B; SP-B; SPB; surfactant protein B; Surfactant, pulmonary-associated protein B; surfactant-associated protein, pulmonary, 3
Protein Function
Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Involvement in Disease
Pulmonary surfactant metabolism dysfunction 1; Respiratory distress syndrome in premature infants.
Shipping & Handling
Shipping
Shipped on dry ice.
Constituents
0.3% Glutathione, 0.79% Tris HCl.
