Product Overview
Description
CLPP-00151140 is recombinant human SUPT16H protein
Applications
ELISA, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE
Sequence Similarities
Belongs to the peptidase M24 family. SPT16 subfamily.
Target Information
Alternative Names
CDC68; Chromatin specific transcription elongation factor 140 kDa subunit; Chromatin-specific transcription elongation factor 140 kDa subunit; Facilitates chromatin transcription complex subunit SPT16; FACT; FACT 140 kDa subunit; FACT complex subunit SPT16; FACTp140; FLJ10857; FLJ14010; hSPT16; SP16H_HUMAN; Suppressor of Ty 16 homolog; Supt16h
Protein Function
Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. The FACT complex is probably also involved in phosphorylation of 'Ser-392' of p53/TP53 via its association with CK2 (casein kinase II).
Tissue Specificity
Ubiquitous.
Involvement in Disease
Neurodevelopmental disorder with dysmorphic facies and thin corpus callosum (NEDDFAC): An autosomal dominant disorder characterized by global developmental delay, impaired intellectual development with poor or absent speech and language, and autistic-like behaviors. Corpus callosum anomalies are visible on brain imaging. Most patients have dysmorphic features including tall forehead, down-slanting palpebral fissures, ear anomalies and broad nasal bridge. Other variably present clinical features include seizures, sleeping difficulties and precocious puberty. The disease may be caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
