Product Overview
Description
CLPP-00151138 is recombinant human SUGT1 protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MASMTGGQENGRGEFAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
Sequence Similarities
Belongs to the SGT1 family. Contains 1 CS domain. Contains 1 SGS domain. Contains 3 TPR repeats.
Predicted Molecular Weight
39 kDa including tags
Target Information
Alternative Names
Protein 40 6 3; Protein 40-6-3; Protein SGT1 homolog; Putative 40 6 3 protein; Sgt1; SGT1 suppressor of G2 allele of SKP1; SGT1_HUMAN; SGT1B protein; sugt1; Suppressor of G2 allele of SKP1 homolog; Suppressor of G2 allele of SKP1 S. cerevisiae homolog of
Protein Function
May play a role in ubiquitination and subsequent proteasomal degradation of target proteins.
Shipping & Handling
Constituents
0.32% Tris HClContains NaCl, KCl, EDTA, Sucrose and DTT.
Shipping
Shipped at 4 °C.