Product Overview
Description
CLPP-00151130 is recombinant human STMN1 protein
Applications
SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Sequence Similarities
Belongs to the stathmin family. Contains 1 SLD (stathmin-like) domain.
Predicted Molecular Weight
19 kDa
Target Information
Alternative Names
C1orf215; Lag; LAP 18; LAP18; Leukemia associated phosphoprotein p18; Leukemia-associated phosphoprotein p18; Metablastin; Oncoprotein 18; OP 18; Op18; p18; p19; Phosphoprotein 19; Phosphoprotein p19; pp17; pp19; PR22; Pr22 protein; Prosolin; Protein Pr22; SMN; Stathmin; Stathmin1; STMN 1; Stmn1; STMN1_HUMAN
Protein Function
Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear.
Tissue Specificity
Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.
Shipping & Handling
Constituents
1.75% Sodium chloride, 25% Glycerol (glycerin, glycerine), 0.004% DTT, 0.81% Sodium phosphate, 0.002% PMSF.
Shipping
Shipped on dry ice.