Product Overview
Description
CLPP-00151126 is recombinant human SRD5A2 protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA
Sequence Similarities
Belongs to the steroid 5-alpha reductase family.
Predicted Molecular Weight
30 kDa including tags
Target Information
Alternative Names
3 oxo 5 alpha steroid 4 dehydrogenase 2; 3-oxo-5-alpha-steroid 4-dehydrogenase 2; 5 alpha SR2; 5 alpha-SR2; 5ART2; e II 5 alpha reductase; EC; MGC138457; Micropenis, included; S5A2_HUMAN; S5AR 2; SR type 2; SRD5A2; Steroid 5 alpha reductase 2; Steroid 5-alpha-reductase 2; Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); Type II 5-alpha reductase
Protein Function
Converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Tissue Specificity
Expressed in high levels in the prostate and many other androgen-sensitive tissues.
Involvement in Disease
Defects in SRD5A2 are the cause of pseudovaginal perineoscrotal hypospadias (PPSH). A form of male pseudohermaphroditism in which 46,XY males show ambiguous genitalia at birth, including perineal hypospadias and a blind perineal pouch, and develop masculinization at puberty. The name of the disorder stems from the finding of a blind-ending perineal opening resembling a vagina and a severely hypospadiac penis with the urethra opening onto the perineum.
Shipping & Handling
Constituents
0.3% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.