Product Overview
Description
CLPP-00151121 is recombinant human SPARC protein
Applications
HPLC, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVIVDHHHHHH
Sequence Similarities
Belongs to the SPARC family. Contains 1 EF-hand domain. Contains 1 follistatin-like domain. Contains 1 Kazal-like domain.
Predicted Molecular Weight
34 kDa including tags
Target Information
Alternative Names
AA517111; Basement membrane protein 40; Basement-membrane protein 40; BM 40; BM-40; BM40; Cysteine rich protein; hm:zeh0062; MGC128090; OI17; ON; Osteonectin; Secreted acidic cystein rich glycoprotein; Secreted protein acidic and cysteine rich; Secreted protein acidic and rich in cysteine; Secreted protein acidic cysteine rich; Secreted protein acidic cysteine rich (osteonectin); SPARC; SPRC; SPRC_HUMAN
Protein Function
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.
Involvement in Disease
Osteogenesis imperfecta 17 (OI17): An autosomal recessive form of osteogenesis imperfecta, a connective tissue disorder characterized by low bone mass, bone fragility and susceptibility to fractures after minimal trauma. Disease severity ranges from very mild forms without fractures to intrauterine fractures and perinatal lethality. Extraskeletal manifestations, which affect a variable number of patients, are dentinogenesis imperfecta, hearing loss, and blue sclerae. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
99% Phosphate Buffer, 0.88% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C for long term.