Product Overview
Description
CLPP-00151114 is recombinant human SKA2 protein, Tagged
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTLYARFKPVAVEQKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL
Sequence Similarities
Belongs to the SKA2 family.
Predicted Molecular Weight
17 kDa including tags
Target Information
Alternative Names
FAM33A; Family with sequence similarity 33, member A; FLJ12758; MGC110975; Protein FAM33A; SKA 2; SKA2; SKA2_HUMAN; Spindle and kinetochore associated complex subunit 2; Spindle and kinetochore associated protein 2; Spindle and kinetochore-associated protein 2; Spindle and KT (kinetochore) associated 2; Spindle and KT associated 2
Protein Function
Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. In the complex, it is required for SKA1 localization. Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules.
Shipping & Handling
Constituents
0.32% Tris HClContains NaCl, KCl, EDTA, Sucrose, DTT.
Shipping
Shipped at 4 °C.
