Product Overview
Description
CLPP-00151110 is recombinant human SIRT3 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMSDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Sequence Similarities
Belongs to the sirtuin family. Class I subfamily. Contains 1 deacetylase sirtuin-type domain.
Predicted Molecular Weight
34 kDa including tags
Target Information
Alternative Names
hSIRT 3; hSIRT3; Mitochondrial nicotinamide adenine dinucleotide dependent deacetylase; NAD dependent deacetylase sirtuin 3 mitochondrial; NAD-dependent protein deacetylase sirtuin-3, mitochondrial; Regulatory protein SIR2 homolog 3; Silent mating type information regulation 2 S.cerevisiae homolog 3; Sir 2 like 3; SIR 2 like protein 3; SIR 3; SIR2 L3; Sir2 like 3; SIR2 like protein 3; SIR2-like protein 3; SIR2L3; SIR3_HUMAN; SIRT 3; SIRT3; Sirtuin 3; Sirtuin silent mating type information regulation 2 homolog 3 (S. cerevisiae); Sirtuin type 3; Sirtuin3
Protein Function
NAD-dependent protein deacetylase. Activates or deactivates mitochondrial target proteins by deacetylating key lysine residues. Known targets include ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA and the ATP synthase subunit ATP5PO. Contributes to the regulation of the cellular energy metabolism. Important for regulating tissue-specific ATP levels. In response to metabolic stress, deacetylates transcription factor FOXO3 and recruits FOXO3 and mitochondrial RNA polymerase POLRMT to mtDNA to promote mtDNA transcription. Acts as a regulator of ceramide metabolism by mediating deacetylation of ceramide synthases CERS1, CERS2 and CERS6, thereby increasing their activity and promoting mitochondrial ceramide accumulation (By similarity).
Tissue Specificity
Widely expressed.
Shipping & Handling
Constituents
0.0154% DTT, 0.316% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
