Product Overview
Description
CLPP-00151108 is recombinant human SIRT2 protein
Applications
Functional Studies, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MASSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSLEHHHHHH
Sequence Similarities
Belongs to the sirtuin family. Contains 1 deacetylase sirtuin-type domain.
Predicted Molecular Weight
36 kDa including tags
Target Information
Alternative Names
FLJ35621; FLJ37491; NAD dependent deacetylase sirtuin 2; NAD dependent protein deacetylase sirtuin 2; NAD-dependent deacetylase sirtuin-2; NAD-dependent protein deacetylase sirtuin-2; Regulatory protein SIR2 homolog 2; Silencing information regulator 2 like; Silent information regulator 2; SIR2; SIR2 like protein 2; Sir2 related protein type 2; SIR2, S. cerevisiae, homolog-loke 2; SIR2-like protein 2; SIR2L; SIR2L2; SIRT2; SIRT2_HUMAN; Sirtuin (silent mating type information regulation 2 homolog) 2 (S.cerevisiae); Sirtuin 2; Sirtuin type 2
Protein Function
NAD-dependent protein deacetylase, which deacetylates the 'Lys-40' of alpha-tubulin. Involved in the control of mitotic exit in the cell cycle, probably via its role in the regulation of cytoskeleton.
Tissue Specificity
Widely expressed. Highly expressed in heart, brain and skeletal muscle, while it is weakly expressed in placenta and lung. Down-regulated in many gliomas suggesting that it may act as a tumor suppressor gene in human gliomas possibly through the regulation of microtubule network.
Shipping & Handling
Constituents
0.0462% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.395% Tris HCl, 0.05% Tween, 50% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped on Dry Ice.
