Product Overview
Description
CLPP-00151118 is recombinant human SIPA1 protein
Applications
ELISA, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
SEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA
Sequence Similarities
Contains 1 PDZ (DHR) domain. Contains 1 Rap-GAP domain.
Target Information
Alternative Names
GTPase activating protein Spa 1; GTPase-activating protein Spa-1; MGC102688; MGC17037; p130 SPA-1; p130 SPA1; Signal induced proliferation associated 1; Signal induced proliferation associated gene 1; Signal induced proliferation associated protein 1; Signal-induced proliferation-associated protein 1; SIPA 1; Sipa-1; Sipa1; SIPA1_HUMAN; Spa1
Protein Function
GTPase activator for the nuclear Ras-related regulatory proteins Rap1 and Rap2 in vitro, converting them to the putatively inactive GDP-bound state. Affects cell cycle progression (By similarity).
Tissue Specificity
Expressed in fetal as well as in adult tissues. Expressed abundantly in the lymphoid tissues such as thymus, spleen and peripheral blood lymphocytes and also shows a significant expression in the spinal cord.
Shipping & Handling
Shipping
Shipped on dry ice.
Constituents
0.31% Glutathione, 0.79% Tris HCl.
