Recombinant Human SIK1 Protein

Cat. No.: CLPP-00151104

Product Size: 10 µg Custom size

Product Overview

Description
CLPP-00151104 is recombinant human SIK1 protein
Purity
> 90%
Applications
Functional Studies, SDS-PAGE
Protein Length
Protein fragment
Animal Free
No
Nature
Recombinant Protein
Species
Human
Form
Liquid
Sequence
MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLY
IVTEFAKNGEMFDYLTSNGHLSENEARKKFWQILSAVEYCHDHHIVHRDLKTENLLLDGNMDIKLADFGFGNFYKSGEPLSTWCGSPPYAAPEVFEGKEY
EGPQLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGRFRIPFFMSQDCESLIRRMLVVDPARRITIAQIRQHRWMRAEPCLPGPACPAFSAHSYTSNLGD
Sequence Similarities
Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. AMPK subfamily. Contains 1 protein kinase domain. Contains 1 UBA domain.
Predicted Molecular Weight
61 kDa including tags
Tags
GST tag N-Terminus

Target Information

Protein Name
SIK1
UniProt No.
Alternative Names
KID2; MSK; myocardial SNF1 like kinase; QIK; Qin-induced kinase; Salt inducible kinase 1; Salt-inducible protein kinase 1; Serine threonine protein kinase SNF1 like kinase 1; Serine threonine protein kinase SNF1LK; Serine/threonine-protein kinase SIK1; Serine/threonine-protein kinase SNF1-like kinase 1; Serine/threonine-protein kinase SNF1LK; SIK-1; SIK1; SIK1_HUMAN; SNF1 like kinase; Snf1lk
Protein Function
Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, gluconeogenesis and lipogenesis regulation, muscle growth and differentiation and tumor suppression. Phosphorylates HDAC4, HDAC5, PPME1, SREBF1, CRTC1/TORC1. Inhibits CREB activity by phosphorylating and inhibiting activity of TORCs, the CREB-specific coactivators, like CRTC2/TORC2 and CRTC3/TORC3 in response to cAMP signaling. Acts as a tumor suppressor and plays a key role in p53/TP53-dependent anoikis, a type of apoptosis triggered by cell detachment: required for phosphorylation of p53/TP53 in response to loss of adhesion and is able to suppress metastasis. Part of a sodium-sensing signaling network, probably by mediating phosphorylation of PPME1: following increases in intracellular sodium, SIK1 is activated by CaMK1 and phosphorylates PPME1 subunit of protein phosphatase 2A (PP2A), leading to dephosphorylation of sodium/potassium-transporting ATPase ATP1A1 and subsequent increase activity of ATP1A1. Acts as a regulator of muscle cells by phosphorylating and inhibiting class II histone deacetylases HDAC4 and HDAC5, leading to promote expression of MEF2 target genes in myocytes. Also required during cardiomyogenesis by regulating the exit of cardiomyoblasts from the cell cycle via down-regulation of CDKN1C/p57Kip2. Acts as a regulator of hepatic gluconeogenesis by phosphorylating and repressing the CREB-specific coactivators CRTC1/TORC1 and CRTC2/TORC2, leading to inhibit CREB activity. Also regulates hepatic lipogenesis by phosphorylating and inhibiting SREBF1. In concert with CRTC1/TORC1, regulates the light-induced entrainment of the circadian clock by attenuating PER1 induction; represses CREB-mediated transcription of PER1 by phosphorylating and deactivating CRTC1/TORC1 (By similarity).
Involvement in Disease
Developmental and epileptic encephalopathy 30 (DEE30): A form of epileptic encephalopathy, a heterogeneous group of severe early-onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent. The disease is caused by variants affecting the gene represented in this entry.;. Defects in SIK1 may be associated with some cancers, such as breast cancers. Loss of SIK1 correlates with poor patient outcome in breast cancers.

Shipping & Handling

pH
pH: 7.5
Constituents
25% Glycerol (glycerin, glycerine), 0.002% PMSF, 0.004% DTT, 0.003% EDTA, 0.31% Glutathione, 0.87% Sodium chloride, 0.79% Tris HCl.
Shipping
Shipped on Dry Ice.
Storage
Store at -80 °C.

For Research Use Only. Not For Clinical Use.

Online Inquiry