Product Overview
Description
CLPP-00151099 is recombinant human SET protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD
Sequence Similarities
Belongs to the nucleosome assembly protein (NAP) family.
Predicted Molecular Weight
36 kDa including tags
Target Information
Alternative Names
2PP2A; HLA DR associated protein II; HLA-DR-associated protein II; I 2PP2A; I-2PP2A; I2PP2A; IGAAD; Inhibitor of granzyme A activated DNase; Inhibitor of granzyme A-activated DNase; Inhibitor of GzmA-activated DNase; inhibitor-2 of protein phosphatase-2A; IPP2A2; PHAPII; Phosphatase 2A inhibitor I2PP2A; protein phosphatase type 2A inhibitor; Protein SET; Set; SET nuclear oncogene; SET translocation; SET translocation (myeloid leukemia-associated); SET_HUMAN; TAF I; TAF IBETA; TAF-I; TAFI; Template activating factor I; Template-activating factor I; Template-Activating Factor-I, chromatin remodelling factor
Protein Function
Multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone chaperoning. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-induced apoptosis, GZMA cleaves SET, disrupting its binding to NME1 and releasing NME1 inhibition. Isoform 1 and isoform 2 are potent inhibitors of protein phosphatase 2A. Isoform 1 and isoform 2 inhibit EP300/CREBBP and PCAF-mediated acetylation of histones (HAT) and nucleosomes, most probably by masking the accessibility of lysines of histones to the acetylases. The predominant target for inhibition is histone H4. HAT inhibition leads to silencing of HAT-dependent transcription and prevents active demethylation of DNA. Both isoforms stimulate DNA replication of the adenovirus genome complexed with viral core proteins; however, isoform 2 specific activity is higher.
Tissue Specificity
Widely expressed. Low levels in quiescent cells during serum starvation, contact inhibition or differentiation. Highly expressed in Wilms' tumor.
Involvement in Disease
A chromosomal aberration involving SET is found in some cases of acute undifferentiated leukemia (AUL). Translocation t(6;9)(q21;q34.1) with NUP214/CAN.
Shipping & Handling
Constituents
0.02% DTT, 0.32% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.