Product Overview
Description
CLPP-00151086 is recombinant human SCGB3A1 protein, Fc Chimera
Protein Length
Full length protein
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG
Sequence Similarities
Belongs to the secretoglobin family. UGRP subfamily.
Predicted Molecular Weight
35 kDa including tags
Target Information
Alternative Names
Cytokine high in normal 1; Cytokine HIN-1; Cytokine HIN1; High in normal 1; HIN 1; HIN1; LU105; MGC87867; Pneumo secretory protein 2; PNSP 2; PnSP-2; PNSP2; Scgb3a1; Secretoglobin family 3A member 1; Secretoglobin family 3A member 1 precursor; Secretoglobin, family 3A, member 1; SG3A1_HUMAN; UGRP2; Uteroglobin related protein 2; Uteroglobin-related protein 2
Protein Function
Secreted cytokine-like protein. Inhibits cell growth in vitro.
Tissue Specificity
Highly expressed in breast tissues. Absent in breast cancer cell lines.
Shipping & Handling
Shipping
Shipped at Room Temperature.
Storage
Store at -20 °C or -80 °C.