Product Overview
Description
CLPP-00151084 is recombinant human PDS5A protein
Applications
ELISA, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDESGPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQDLAKKAAPAERQIDLQR
Sequence Similarities
Belongs to the PDS5 family. Contains 1 HEAT repeat.
Target Information
Alternative Names
Cell proliferation inducing protein 54; Cell proliferation-inducing gene 54 protein; KIAA0648; PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae); PDS5A; PDS5A_HUMAN; PIG54; SCC-112; SCC112; Sister chromatid cohesion protein 112; Sister chromatid cohesion protein PDS5 homolog A
Protein Function
Probable regulator of sister chromatid cohesion in mitosis which may stabilize cohesin complex association with chromatin. May couple sister chromatid cohesion during mitosis to DNA replication. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair.
Tissue Specificity
Highest level in colon. Low levels in lung, ovary, breast and kidney. Reduced level in renal tumor tissue. Isoform 2 is expressed in kidney.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
