Product Overview
Description
CLPP-00151076 is recombinant human S100A13 protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Predicted Molecular Weight
12 kDa
Sequence Similarities
Belongs to the S-100 family. Contains 2 EF-hand domains.
Endotoxin Level
< 1.000 Eu/µg
Target Information
Alternative Names
Protein S100 A13; Protein S100-A13; S100 calcium binding protein A13; S100 calcium-binding protein A13; S100a13; S10AD_HUMAN
Protein Function
Plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine (By similarity).
Tissue Specificity
Expressed in heart and skeletal muscle.
Shipping & Handling
Shipping
Shipped at 4 °C.
Constituents
0.61% Tris, 0.87% Sodium chloride, 5% Trehalose.
