Product Overview
Description
CLPP-00151072 is recombinant human S100A1 protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MKHHHHHHASGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Predicted Molecular Weight
12 kDa including tags
Sequence Similarities
Belongs to the S-100 family. Contains 2 EF-hand domains.
Endotoxin Level
< 1.000 Eu/µg
Target Information
Alternative Names
Bpb; NEF; Protein S100-A1; S-100 protein alpha chain; S-100 protein subunit alpha; S100; S100 alpha; S100 Alpha Chain; S100 Beta Chain; S100 Calcium Binding Protein A1; S100 Calcium Binding Protein B; S100 Calcium Binding Protein Beta Neural; S100 calcium-binding protein A1; S100 protein alpha polypeptide; S100A; s100a1; S10A1_HUMAN
Protein Function
Small calcium binding protein that plays important roles in several biological processes such as Ca(2+) homeostasis, chondrocyte biology and cardiomyocyte regulation. In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers conformational changes. These changes allow interactions with specific target proteins and modulate their activity. Regulates a network in cardiomyocytes controlling sarcoplasmic reticulum Ca(2+) cycling and mitochondrial function through interaction with the ryanodine receptors RYR1 and RYR2, sarcoplasmic reticulum Ca(2+)-ATPase/ATP2A2 and mitochondrial F1-ATPase. Facilitates diastolic Ca(2+) dissociation and myofilament mechanics in order to improve relaxation during diastole.
Tissue Specificity
Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.
Shipping & Handling
Shipping
Shipped at 4 °C.
Constituents
0.29% Sodium chloride, 0.24% Tris.
