Product Overview
Description
CLPP-00151070 is recombinant human S100A6 protein
Protein Length
Full length protein
Nature
Recombinant Protein
Endotoxin Level
< 0.100 Eu/µg
Sequence
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Sequence Similarities
Belongs to the S-100 family. Contains 2 EF-hand domains.
Predicted Molecular Weight
10 kDa
Target Information
Alternative Names
2A9; 5B10; CABP; CACY; Calcyclin; Growth factor inducible protein 2A9; Growth factor-inducible protein 2A9; MLN 4; MLN4; OTTHUMP00000015472; OTTHUMP00000015473; PRA; PRAGrowth factor inducible protein 2A9; Prolactin receptor associated protein; Prolactin receptor-associated protein; Protein S100 A6; Protein S100-A6; S100 A6; S100 calcium binding protein A6; S100 calcium binding protein A6 (calcyclin); S100 calcium-binding protein A6; S100A6; S10A6_HUMAN
Protein Function
May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.
Shipping & Handling
Constituents
94% PBS, 5% Trehalose.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.