Product Overview
Description
CLPP-00151069 is recombinant human S100A2 protein, Fc Chimera
Protein Length
Protein fragment
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Sequence Similarities
Belongs to the S-100 family. Contains 2 EF-hand domains.
Predicted Molecular Weight
38 kDa including tags
Target Information
Alternative Names
CAN19; MGC111539; Protein S 100L; Protein S-100L; Protein S100 A2; Protein S100-A2; Protein S100L; S100 A2; S100 calcium binding protein A2; S100 calcium-binding protein A2; S100A2; S100L; S10A2_HUMAN
Protein Function
May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes. May also play a role in suppressing tumor cell growth.
Tissue Specificity
A subset of epithelial cells including normal human mammary epithelial cells and keratinocytes.
Shipping & Handling
Constituents
0.75% Glycine, 0.06% Sodium chloride, 0.61% Tris.
Shipping
Shipped at Room Temperature.
Storage
Store at -20 °C or -80 °C.
