Product Overview
Description
CLPP-00151064 is recombinant human MST1R protein, His tag
Protein Length
Protein fragment
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPGSWQQDHCPPKL
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. Contains 3 IPT/TIG domains. Contains 1 protein kinase domain. Contains 1 Sema domain.
Predicted Molecular Weight
60 kDa including tags
Target Information
Alternative Names
c met related tyrosine kinase; CD136; CD136 antigen; CDw136; Macrophage stimulating 1 receptor; Macrophage stimulating 1 receptor (c met related tyrosine kinase); MACROPHAGE STIMULATING PROTEIN RECEPTOR; Macrophage stimulating protein receptor alpha chain; Macrophage stimulating protein receptor beta chain; Macrophage-Stimulating 1 Receptor (MST1R); Macrophage-stimulating protein receptor beta chain; MSP receptor; Mst1r; MST1R variant RON30; MST1R variant RON62; NPCA3; p185 RON; p185-Ron; Protein-tyrosine kinase 8; PTK 8; ptk8; PTK8 protein tyrosine kinase 8; Recepteur d’origine nantais (RON); RON; RON protein tyrosine kinase; RON variant E2E3; RON_HUMAN; Soluble RON variant 1; Soluble RON variant 2; Soluble RON variant 3; Soluble RON variant 4; Stem cell derived tyrosine kinase
Protein Function
Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to MST1 ligand. Regulates many physiological processes including cell survival, migration and differentiation. Ligand binding at the cell surface induces autophosphorylation of RON on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with the PI3-kinase subunit PIK3R1, PLCG1 or the adapter GAB1. Recruitment of these downstream effectors by RON leads to the activation of several signaling cascades including the RAS-ERK, PI3 kinase-AKT, or PLCgamma-PKC. RON signaling activates the wound healing response by promoting epithelial cell migration, proliferation as well as survival at the wound site. Also plays a role in the innate immune response by regulating the migration and phagocytic activity of macrophages. Alternatively, RON can also promote signals such as cell migration and proliferation in response to growth factors other than MST1 ligand.
Tissue Specificity
Keratinocytes and lung.
Involvement in Disease
Nasopharyngeal carcinoma, 3 (NPCA3): A form of nasopharyngeal carcinoma, a malignant neoplasm that originates in the nasopharyngeal epithelium and includes 4 subtypes: keratinizing squamous cell, non-keratinizing, basaloid squamous cell, and papillary adenocarcinoma. Disease susceptibility is associated with variants affecting the gene represented in this entry.
Shipping & Handling
Shipping
Shipped at Room Temperature.
Storage
Store at -20 °C or -80 °C.
