Product Overview
Description
CLPP-00151059 is recombinant human RICTOR protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE
Sequence Similarities
Belongs to the RICTOR family.
Predicted Molecular Weight
36 kDa including tags
Target Information
Alternative Names
AVO3; AVO3 homolog; DKFZp686B11164; hAVO3; KIAA1999; Likely ortholog of mouse TORC2 specific protein AVO3 (S. cerevisiae); mAVO3; MGC39830; PIA; Pianissimo; Rapamycin insensitive companion of mTOR; Rapamycin-insensitive companion of mTOR; Rictor; RICTR; RICTR_HUMAN; RPTOR independent companion of MTOR complex 2; TORC2 specific protein AVO3
Protein Function
Subunit of mTORC2, which regulates cell growth and survival in response to hormonal signals. mTORC2 is activated by growth factors, but, in contrast to mTORC1, seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 plays a critical role in AKT1 'Ser-473' phosphorylation, which may facilitate the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDK1 which is a prerequisite for full activation. mTORC2 regulates the phosphorylation of SGK1 at 'Ser-422'. mTORC2 also modulates the phosphorylation of PRKCA on 'Ser-657'. Plays an essential role in embryonic growth and development.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.