Product Overview
Description
CLPP-00151056 is recombinant human RHOB protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCC
Sequence Similarities
Belongs to the small GTPase superfamily. Rho family.
Predicted Molecular Weight
24 kDa including tags
Target Information
Alternative Names
Aplysia RAS-related homolog 6; ARH6; ARHB; H6; MST081; MSTP081; oncogene RHO H6; ras homolog family member B; ras homolog gene family, member B; Rho cDNA clone 6; Rho related GTP binding protein RhoB Precursor; Rho-related GTP-binding protein RhoB; Rhob; RHOB_HUMAN; RHOH6
Protein Function
Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development.
Shipping & Handling
Constituents
0.0308% DTT, 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 1.16% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
