Product Overview
Description
CLPP-00151054 is recombinant human RHOA protein
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Sequence Similarities
Belongs to the small GTPase superfamily. Rho family.
Target Information
Alternative Names
Aplysia ras related homolog 12; ARH12; ARHA; H 12; H12; Oncogene RHO H12; Ras homolog family member A; Ras homolog gene family member A; Rho A; Rho cDNA clone 12; RHO H12; RHO12; RHOA; RHOA_HUMAN; RHOH12; Small GTP binding protein Rho A; Transforming protein Rho A; Transforming protein RhoA
Protein Function
Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP.
Involvement in Disease
Ectodermal dysplasia with facial dysmorphism and acral, ocular, and brain anomalies (EDFAOB): A neuroectodermal syndrome characterized by linear hypopigmentation, alopecia, apparently asymptomatic leukoencephalopathy, and facial, ocular, dental and acral anomalies. Patients show no intellectual or neurologic impairment. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
0.443% GDP, 0.019% Magnesium chloride, 0.077% DTT, 0.595% HEPES, 0.232% Sodium chloride.
Shipping
Shipped on dry ice.
