Product Overview
Description
CLPP-00151048 is recombinant human RCC1 protein
Applications
SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Sequence Similarities
Contains 7 RCC1 repeats.
Target Information
Alternative Names
Cell cycle regulatory protein; CHC 1; CHC1; Chromosome condensation 1; Chromosome condensation protein 1; Guanine nucleotide releasing protein; HERC2; Ran GEF; RanGEF; RCC 1; RCC1; RCC1 I; RCC1_HUMAN; Regulator of chromosome condensation; Regulator of chromosome condensation 1; SHEP1; SNHG3 RCC1; SNHG3 RCC1 readthrough transcript
Protein Function
Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis. Contributes to the generation of high levels of chromosome-associated, GTP-bound RAN, which is important for mitotic spindle assembly and normal progress through mitosis. Via its role in maintaining high levels of GTP-bound RAN in the nucleus, contributes to the release of cargo proteins from importins after nuclear import. Involved in the regulation of onset of chromosome condensation in the S phase. Binds both to the nucleosomes and double-stranded DNA.
Shipping & Handling
Constituents
0.29% Sodium chloride, 0.476% HEPES, 0.0308% DTE (1,4-Dithioerythritol).
Shipping
Shipped on dry ice.