Recombinant Human Raptor Protein

Cat. No.: CLPP-00151042

Product Size: 2 µg Custom size

Product Overview

Description
CLPP-00151042 is recombinant human RPTOR protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Full length protein
Animal Free
No
Nature
Recombinant Protein
Species
Human
Form
Liquid
Sequence
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMW
Sequence Similarities
Belongs to the WD repeat RAPTOR family. Contains 7 WD repeats.
Predicted Molecular Weight
68 kDa including tags

Target Information

Protein Name
RPTOR
UniProt No.
Alternative Names
KIAA1303; KOG1; Mip1; P150 target of rapamycin (TOR) scaffold protein; p150 target of rapamycin (TOR) scaffold protein containing WD repeats; P150 target of rapamycin (TOR)-scaffold protein; Raptor; Regulatory associated protein of mTOR; Regulatory associated protein of MTOR complex 1; Regulatory-associated protein of mTOR; RPTOR; RPTOR_HUMAN
Protein Function
Involved in the control of the mammalian target of rapamycin complex 1 (mTORC1) activity which regulates cell growth and survival, and autophagy in response to nutrient and hormonal signals; functions as a scaffold for recruiting mTORC1 substrates. mTORC1 is activated in response to growth factors or amino acids. Growth factor-stimulated mTORC1 activation involves a AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Amino acid-signaling to mTORC1 requires its relocalization to the lysosomes mediated by the Ragulator complex and the Rag GTPases. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation. Involved in ciliogenesis. mTORC1 complex in excitatory neuronal transmission is required for the prosocial behavior induced by the psychoactive substance lysergic acid diethylamide (LSD) (By similarity).
Tissue Specificity
Highly expressed in skeletal muscle, and in a lesser extent in brain, lung, small intestine, kidney and placenta.

Shipping & Handling

pH
pH: 8.0
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
Storage
Store at -80 °C.

For Research Use Only. Not For Clinical Use.

Online Inquiry