Product Overview
Description
CLPP-00151029 is recombinant human RAB35 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC
Sequence Similarities
Belongs to the small GTPase superfamily. Rab family.
Predicted Molecular Weight
25 kDa including tags
Target Information
Alternative Names
GTP binding protein RAY; GTP-binding protein RAY; H ray; OTTHUMP00000240256; OTTHUMP00000240257; OTTHUMP00000240258; OTTHUMP00000240259; RAB1C; Rab35; RAB35 member RAS oncogene family; RAB35, member RAS oncogene family; RAB35_HUMAN; Ras related protein Rab 1C; Ras related protein rab 1c (GTP binding protein ray); Ras related protein Rab35; Ras-related protein Rab-1C; Ras-related protein Rab-35; RAY
Protein Function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in the process of endocytosis and is an essential rate-limiting regulator of the fast recycling pathway back to the plasma membrane. During cytokinesis, required for the postfurrowing terminal steps, namely for intercellular bridge stability and abscission, possibly by controlling phosphatidylinositol 4,5-bis phosphate (PIP2) and SEPT2 localization at the intercellular bridge. May indirectly regulate neurite outgrowth. Together with TBC1D13 may be involved in regulation of insulin-induced glucose transporter SLC2A4/GLUT4 translocation to the plasma membrane in adipocytes.
Shipping & Handling
Constituents
0.02% DTT, 0.32% Tris HCl, 40% Glycerol (glycerin, glycerine), 0.88% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
