Product Overview
Description
CLPP-00151028 is recombinant human RAB21 protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MASMTGGQQMGRGHHHHHHENLYFQGGEFAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG
Sequence Similarities
Belongs to the small GTPase superfamily. Rab family.
Predicted Molecular Weight
28 kDa including tags
Target Information
Alternative Names
KIAA0118; RAB 21; RAB21; RAB21, member RAS oncogene family; RAB21_HUMAN; Ras-related protein Rab-21
Protein Function
Small GTPase involved in membrane trafficking control. During the mitosis of adherent cells, controls the endosomal trafficking of integrins which is required for the successful completion of cytokinesis. Regulates integrin internalization and recycling, but does not influence the traffic of endosomally translocated receptors in general (By similarity). As a result, may regulate cell adhesion and migration (By similarity). Involved in neurite growth (By similarity). Following SBF2/MTMT13-mediated activation in response to starvation-induced autophagy, binds to and regulates SNARE protein VAMP8 endolysosomal transport required for SNARE-mediated autophagosome-lysosome fusion. Modulates protein levels of the cargo receptors TMED2 and TMED10, and required for appropriate Golgi localization of TMED10.
Tissue Specificity
Widely expressed. In jejunal tissue, predominantly expressed in the apical region of the epithelial cell layer of the villi, weak expression, if any, in the crypt epithelium. Capillary endothelium and some cell types in the lamina propria also show expression.
Shipping & Handling
Constituents
0.32% Tris HClContains NaCl, KCl, EDTA, Sucrose and DTT.
Shipping
Shipped at 4 °C.
