Product Overview
Description
CLPP-00151027 is recombinant human QSOX1 protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
KALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFF
Sequence Similarities
Belongs to the quiescin-sulfhydryl oxidase (QSOX) family. Contains 1 ERV/ALR sulfhydryl oxidase domain. Contains 1 thioredoxin domain.
Predicted Molecular Weight
37 kDa including tags
Target Information
Alternative Names
FLJ34858; hQSOX; Human quiescin (Q6) mRNA, partial cds; Q6; QSCN6; QSOX1; QSOX1_HUMAN; Quiescin Q6; Quiescin Q6 sulfhydryl oxidase 1; Skin sulfhydryl oxidase; Sox; Sulfhydryl oxidase 1; Sulfhydryl oxidase 1 precursor
Protein Function
Catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. Plays a role in disulfide bond formation in a variety of extracellular proteins. In fibroblasts, required for normal incorporation of laminin into the extracellular matrix, and thereby for normal cell-cell adhesion and cell migration.
Tissue Specificity
Expressed in heart, placenta, lung, liver, skeletal muscle, pancreas and very weakly in brain and kidney.
Shipping & Handling
Constituents
0.3% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
