Product Overview
Description
CLPP-00151021 is recombinant human PTHLH protein
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Sequence Similarities
Belongs to the parathyroid hormone family.
Target Information
Alternative Names
HHM; MGC14611; Osteostatin; Parathyroid hormon like hormone isoform 2 preproprotein; Parathyroid hormone like hormone; Parathyroid hormone like hormone isoform 1 preproprotein; Parathyroid hormone like protein; Parathyroid hormone like related protein; Parathyroid hormone related protein; Parathyroid hormone-like protein; Parathyroid like protein; PLP; PTH related protein; PTH-rP; PTHLH; PTHR; PTHR_HUMAN; PTHrP; PTHrP[107-139]
Protein Function
Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Up-regulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath (By similarity). Promotes colon cancer cell migration and invasion in an integrin alpha-6/beta-1-dependent manner through activation of Rac1; Osteostatin is a potent inhibitor of osteoclastic bone resorption.
Tissue Specificity
Ubiquitous. Also expressed in the mammary gland.
Involvement in Disease
Brachydactyly E2.
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.