Product Overview
Description
CLPP-00151010 is recombinant human PFN1 protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Sequence Similarities
Belongs to the profilin family.
Target Information
Alternative Names
Actin binding protein; ALS18; Epididymis tissue protein Li 184a; OTTHUMP00000125244; Pfn; PFN 1; PFN1; PROF1_HUMAN; Profilin I; Profilin-1; Profilin1; ProfilinI
Protein Function
Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. Inhibits androgen receptor (AR) and HTT aggregation and binding of G-actin is essential for its inhibition of AR.
Involvement in Disease
Amyotrophic lateral sclerosis 18 (ALS18): A neurodegenerative disorder affecting upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis. Sensory abnormalities are absent. The pathologic hallmarks of the disease include pallor of the corticospinal tract due to loss of motor neurons, presence of ubiquitin-positive inclusions within surviving motor neurons, and deposition of pathologic aggregates. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
0.316% Tris HCl, 10% Glycerol.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
