Product Overview
Description
CLPP-00151006 is recombinant human PRMT1 protein
Applications
Functional Studies, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFK
DKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEE
VELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQY
KDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFT
SPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTG
EEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Sequence Similarities
Belongs to the protein arginine N-methyltransferase family.
Predicted Molecular Weight
68 kDa including tags
Target Information
Alternative Names
ANM 1; ANM1; ANM1_HUMAN; HCP 1; HCP1; Heterogeneous nuclear ribonucleoprotein methyltransferase 1 like 2; Heterogeneous nuclear ribonucleoproteins methyltransferase like 2; Heterogeneous nuclear ribonucleoproteins methyltransferase like2; Histone-arginine N-methyltransferase PRMT1; HMT 2; HMT1 (hnRNP methyltransferase S. cerevisiae) like 2; HMT1 hnRNP methyltransferase; HMT1 hnRNP methyltransferase like 2; HMT1 hnRNP methyltransferase like 2 (S. cerevisiae); HMT2; HRMT1 L2; HRMT1L 2; HRMT1L2; Human mRNA for suppressor for yeast mutant; Human mRNA for suppressor for yeast mutant complete cds; Interferon receptor 1 bound protein 4; Interferon receptor 1 bound protein4; Interferon receptor 1-bound protein 4; Interferon receptor 1bound protein 4; IR1 B4; IR1B 4; IR1B4; Mrmt 1; Mrmt1; PRMT 1; PRMT1; Protein arginine methyltransferase 1; Protein arginine N methyltransferase 1; Protein arginine N methyltransferase1; Protein arginine N-methyltransferase 1; R1B4; S. cerevisiae like 2
Protein Function
Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in proteins such as ESR1, histone H2, H3 and H4, ILF3, HNRNPA1, HNRNPD, NFATC2IP, SUPT5H, TAF15, EWS, HABP4, SERBP1, RBM15, FOXO1, CHTOP and MAP3K5/ASK1. Constitutes the main enzyme that mediates monomethylation and asymmetric dimethylation of histone H4 'Arg-4' (H4R3me1 and H4R3me2a, respectively), a specific tag for epigenetic transcriptional activation. May be involved in the regulation of TAF15 transcriptional activity, act as an activator of estrogen receptor (ER)-mediated transactivation, play a key role in neurite outgrowth and act as a negative regulator of megakaryocytic differentiation, by modulating p38 MAPK pathway. Methylates RBM15, promoting ubiquitination and degradation of RBM15. Methylates FOXO1 and retains it in the nucleus increasing its transcriptional activity. Methylates CHTOP and this methylation is critical for its 5-hydroxymethylcytosine (5hmC)-binding activity. Methylates MAP3K5/ASK1 at 'Arg-78' and 'Arg-80' which promotes association of MAP3K5 with thioredoxin and negatively regulates MAP3K5 association with TRAF2, inhibiting MAP3K5 stimulation and MAP3K5-induced activation of JNK. Methylates H4R3 in genes involved in glioblastomagenesis in a CHTOP- and/or TET1-dependent manner. Plays a role in regulating alternative splicing in the heart (By similarity).
Tissue Specificity
Widely expressed.
Shipping & Handling
Constituents
0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol (glycerin, glycerine), 0.88% Sodium chloride.
Shipping
Shipped on dry ice.
