Recombinant Human PI3 Kinase p110 beta Protein

Cat. No.: CLPP-00150987

Product Size: 10 µg Custom size

Product Overview

Description
CLPP-00150987 is recombinant human PIK3CB protein
Applications
ELISA, Western Blot
Protein Length
Protein fragment
Animal Free
No
Nature
Recombinant Protein
Species
Human
Form
Liquid
Sequence
EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY
Sequence Similarities
Belongs to the PI3/PI4-kinase family. Contains 1 PI3K/PI4K domain.
Tags
GST tag N-Terminus

Target Information

Protein Name
PIK3CB
UniProt No.
Alternative Names
5-bisphosphate 3-kinase 110 kDa catalytic subunit beta; 5-bisphosphate 3-kinase catalytic subunit beta isoform; DKFZp779K1237; MGC133043; OTTHUMP00000216901; OTTHUMP00000216904; p110 BETA; p110Beta; Phosphatidylinositol 3 kinase catalytic beta polypeptide; Phosphatidylinositol 4 5 bisphosphate 3 kinase 110 kDa catalytic subunit beta; Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit beta isoform; Phosphatidylinositol-4; Phosphoinositide 3 kinase catalytic beta polypeptide; PI3 kinase p110 subunit beta; PI3-kinase subunit beta; PI3K; PI3K beta; PI3K-beta; PI3Kbeta; PI3KCB; PIK3C1; Pik3cb; PK3CB_HUMAN; PtdIns 3 kinase p110; PtdIns-3-kinase subunit beta; PtdIns-3-kinase subunit p110-beta
Protein Function
Phosphoinositide-3-kinase (PI3K) phosphorylates phosphatidylinositol derivatives at position 3 of the inositol ring to produce 3-phosphoinositides. Uses ATP and PtdIns(4,5)P2 (phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Involved in the activation of AKT1 upon stimulation by G-protein coupled receptors (GPCRs) ligands such as CXCL12, sphingosine 1-phosphate, and lysophosphatidic acid. May also act downstream receptor tyrosine kinases. Required in different signaling pathways for stable platelet adhesion and aggregation. Plays a role in platelet activation signaling triggered by GPCRs, alpha-IIb/beta-3 integrins (ITGA2B/ ITGB3) and ITAM (immunoreceptor tyrosine-based activation motif)-bearing receptors such as GP6. Regulates the strength of adhesion of ITGA2B/ ITGB3 activated receptors necessary for the cellular transmission of contractile forces. Required for platelet aggregation induced by F2 (thrombin) and thromboxane A2 (TXA2). Has a role in cell survival. May have a role in cell migration. Involved in the early stage of autophagosome formation. Modulates the intracellular level of PtdIns3P (phosphatidylinositol 3-phosphate) and activates PIK3C3 kinase activity. May act as a scaffold, independently of its lipid kinase activity to positively regulate autophagy. May have a role in insulin signaling as scaffolding protein in which the lipid kinase activity is not required. May have a kinase-independent function in regulating cell proliferation and in clathrin-mediated endocytosis. Mediator of oncogenic signal in cell lines lacking PTEN. The lipid kinase activity is necessary for its role in oncogenic transformation. Required for the growth of ERBB2 and RAS driven tumors. Has also a protein kinase activity showing autophosphorylation.
Tissue Specificity
Expressed ubiquitously.

Shipping & Handling

pH
pH: 8.0
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
Storage
Store at -80 °C.

For Research Use Only. Not For Clinical Use.

Online Inquiry